PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007638m
Common NameCARUB_v10007638mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 320aa    MW: 34786.6 Da    PI: 6.3751
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007638mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.31e-191459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ll ++v+++G+++W++I++ ++ gR++k+c++rw + 
  Carubv10007638m 14 KGPWSPEEDDLLQRLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 59
                     79******************************.***********985 PP

2Myb_DNA-binding54.13.7e-1768110347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +++a++++G++ W+tI+r ++ gRt++ +k++w++ 
  Carubv10007638m  68 AFSQEEDETIIRAHARFGNK-WATISRLLN-GRTDNAIKNHWNST 110
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.985964IPR017930Myb domain
SuperFamilySSF466891.58E-3111107IPR009057Homeodomain-like
SMARTSM007179.4E-181362IPR001005SANT/Myb domain
PfamPF002499.1E-201459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-261567IPR009057Homeodomain-like
CDDcd001675.89E-171658No hitNo description
SMARTSM007172.8E-1465113IPR001005SANT/Myb domain
PROSITE profilePS5129420.29366115IPR017930Myb domain
CDDcd001671.61E-1168111No hitNo description
Gene3DG3DSA:1.10.10.604.3E-2268114IPR009057Homeodomain-like
PfamPF002491.4E-1468110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSNPTTRKNM ERIKGPWSPE EDDLLQRLVQ KHGPRNWSLI SKSIPGRSGK SCRLRWCNQL  60
SPEVEHRAFS QEEDETIIRA HARFGNKWAT ISRLLNGRTD NAIKNHWNST LKRKCSVEGQ  120
SCDFGGNGGY DGNLGEEQPL KRTASGGGVS TGLYMSPGSP SGSDVSEQSS GQGQQHVFKP  180
TVRSDVTASS SAEDPPTYLS LSLPWTETAR VNEAPQPNQD TVMDGGYTAE LFPVRKEEEV  240
EVEDEAKGIS GGFGGEFLTV VQEMIRTEVR SYMADLQRGN VGASGGGSGG GSCMPQSVNS  300
RRVGFREFIV NQIGIGKME*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-40911553159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-40911553159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615910.0AL161591.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 87.
GenBankAY0639120.0AY063912.1 Arabidopsis thaliana putative myb-related protein (At4g37260) mRNA, complete cds.
GenBankAY0912670.0AY091267.1 Arabidopsis thaliana putative myb-related protein (At4g37260) mRNA, complete cds.
GenBankAY5196130.0AY519613.1 Arabidopsis thaliana MYB transcription factor (At4g37260) mRNA, complete cds.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ997070.0Z99707.1 Arabidopsis thaliana DNA chromosome 4, ESSA I AP2 contig fragment No. 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286095.10.0hypothetical protein CARUB_v10007638mg
SwissprotQ9FDW13e-91MYB44_ARATH; Transcription factor MYB44
TrEMBLR0H6600.0R0H660_9BRAS; Uncharacterized protein
STRINGAT4G37260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.10.0myb domain protein 73